Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FOXO3A Rabbit pAb |
---|---|
Catalog No. | A0102 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 558-635 of mouse FOXO3A (NP_062714.1). |
---|---|
Sequence | LSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDAD |
Gene ID | |
Swiss Prot | |
Synonyms | Fkhr2; FKHRL1; Foxo3a; 1110048B16Rik; 2010203A17Rik; FOXO3A |
Calculated MW | 71kDa |
Observed MW | 80-90kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, Jurkat, 293T, PC-3 |
Cellular location | Cytoplasm, Nucleus, cytosol. |
Customer validation | WB(Danio rerio, Mus musculus, Homo sapiens, Rattus norvegicus, Mus musculus) Co-IP(Rattus norvegicus) IP(Rattus norvegicus) IF(Mus musculus) IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0102? Please let us know so that we can cite the reference in this datasheet.