Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FSHR Rabbit pAb |
---|---|
Catalog No. | A3172 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 631-695 of human FSHR (NP_000136.2). |
---|---|
Sequence | KNFRRDFFILLSKCGCYEMQAQIYRTETSSTVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN |
Gene ID | |
Swiss Prot | |
Synonyms | LGR1; ODG1; FSHR1; FSHRO; FSHR |
Calculated MW | 78kDa |
Observed MW | 75kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver |
Cellular location | Cell membrane, Multi-pass membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens) IF(Mus musculus, Gallus gallus, Rattus norvegicus, Other) Other(Mus musculus) WB(Gallus gallus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3172? Please let us know so that we can cite the reference in this datasheet.