Review (1)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | FSP1/S100A4 Rabbit pAb |
---|---|
Catalog No. | A1631 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human FSP1/S100A4 (NP_002952.1). |
---|---|
Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
Gene ID | |
Swiss Prot | |
Synonyms | 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98; FSP1/S100A4 |
Calculated MW | 12kDa |
Observed MW | 12kDa/ |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, A549, A-375, NIH/3T3 |
Cellular location | extracellular exosome, extracellular region, extracellular space, neuron projection, nucleus, perinuclear region of cytoplasm. |
Customer validation | (mouse cells) WB(Mus musculus, Homo sapiens) IF(Rattus norvegicus) IHC(Homo sapiens, Mus musculus) IHC(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1631? Please let us know so that we can cite the reference in this datasheet.