제품 > 항체 > 다중클론항체(pAb)

Fam221b Rabbit pAb (A20384)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Fam221b Rabbit pAb (A20384) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Fam221b Rabbit pAb (A20384)

Immunohistochemistry analysis of paraffin-embedded rat testis using Fam221b Rabbit pAb (A20384) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Fam221b Rabbit pAb
Catalog No.	A20384
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Orthologous to human FAM221B (family with sequence similarity 221 member B).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 280-487 of mouse Fam221b (NP_780726.1).
Sequence	EKRAGGVTSRPVVPAKRAELVEMAKAVHREQFDDQVNNLFQWEKDSTLKAIQTGIYIGWRCPHYLWDCFRIGDESKCFCGHLLREHQIISDLSVPCSVSQCRCLMFCFIPSRPEEVGEFWLKKRATFDPKAWRAQCRCKHTHEEHAATGAHPCRHRGCFCPSFESNFLCVACDRRWEEHETFFETGDTRRKGKRPYGANNIKNWHRTY
Gene ID
Swiss Prot
Synonyms	4930412F15Rik; Fam221b
Calculated MW	54kDa
Observed MW	55kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse testis, Rat testis
Cellular location