제품 > 항체 > 다중클론항체(pAb)

Fibronectin Rabbit pAb (A25907)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from U-87 MG cells using Fibronectin Rabbit pAb (A25907) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Fibronectin Rabbit pAb
Catalog No.	A25907
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2205-2477 of mouse Fibronectin (NP_034363.1).
Sequence	ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Gene ID
Swiss Prot
Synonyms	Fn; Fn-1; E330027I09
Calculated MW	273kDa
Observed MW	300kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87 MG
Cellular location	Secreted, extracellular space, extracellular matrix, Secreted .