제품 > 항체 > 단일클론항체(mAb)

GCLC Rabbit mAb (A25132)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from A549 cells using GCLC Rabbit mAb (A25132) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - GCLC Rabbit mAb (A25132)

Confocal imaging of RAW 264.7 cells using GCLC Rabbit mAb (A25132, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	GCLC Rabbit mAb
Catalog No.	A25132
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63489

Background

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human GCLC(NP_001489.1).
Sequence	MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDHENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEANMRKRRKEATSIL
Gene ID
Swiss Prot
Synonyms	GCL; GCS; GLCL; GLCLC; GCLC
Calculated MW	73kDa
Observed MW	73kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A549
Cellular location	cytosol, glutamate-cysteine ligase complex, mitochondrion
Customer validation	WB(Mus musculus)