제품 > 항체 > 다중클론항체(pAb)

GFPT2 Rabbit pAb (A15374)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using GFPT2 antibody (A15374) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - GFPT2 Rabbit pAb (A15374)

Immunofluorescence analysis of L929 cells using GFPT2 antibody (A15374) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	GFPT2 Rabbit pAb
Catalog No.	A15374
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable glutamine-fructose-6-phosphate transaminase (isomerizing) activity. Predicted to be involved in UDP-N-acetylglucosamine metabolic process; fructose 6-phosphate metabolic process; and protein N-linked glycosylation. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in cytosol. Implicated in type 2 diabetes mellitus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 200-260 of human GFPT2 (NP_005101.1).
Sequence	RGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRLDSSACLHAVGDKAVEFFF
Gene ID
Swiss Prot
Synonyms	GFAT; GFAT2; GFAT 2
Calculated MW	77kDa
Observed MW	77kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HeLa, A375, NIH/3T3, Mouse heart, Mouse pancreas, Mouse testis, Rat heart
Cellular location	cytosol
Customer validation	ChIP(Rosa hybrid cultivar) WB(Homo sapiens)