Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GJB1 Rabbit pAb |
---|---|
Catalog No. | A10112 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 214-283 of human GJB1 (NP_000157.1). |
---|---|
Sequence | IRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Gene ID | |
Swiss Prot | |
Synonyms | CMTX; CX32; CMTX1 |
Calculated MW | 32kDa |
Observed MW | 32kDa/36kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | LO2, MCF7, 293T, A375, Mouse brain, Mouse liver, Rat liver, Rat kidney |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, gap junction |
Customer validation | WB(Homo sapiens) IF(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10112? Please let us know so that we can cite the reference in this datasheet.