제품 > 항체 > 다중클론항체(pAb)

GLI2 Rabbit pAb (A6510)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using GLI2 antibody (A6510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Review

Overview

Product name	GLI2 Rabbit pAb
Catalog No.	A6510
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and promoter-specific chromatin binding activity. Acts upstream of or within several processes, including animal organ development; chordate embryonic development; and regulation of smoothened signaling pathway. Located in several cellular components, including axoneme; ciliary tip; and nuclear speck. Is expressed in several structures, including central nervous system; embryo mesenchyme; eye; genitourinary system; and jaw. Human ortholog(s) of this gene implicated in Culler-Jones syndrome; holoprosencephaly 9; and spina bifida. Orthologous to human GLI2 (GLI family zinc finger 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of mus musculus GLI2 (NP_001074594.1).
Sequence	METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPIDMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQ
Gene ID
Swiss Prot
Synonyms	GLI2; CJS; HPE9; PHS2; THP1; THP2; Gli2
Calculated MW	168kDa
Observed MW	90kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Mouse brain, Mouse heart, Mouse ovary, Mouse pancreas, Rat brain
Cellular location	Cytoplasm, Nucleus
Customer validation	(Mouse liver) WB(Mus musculus)