제품 > 항체 > 단일클론항체(mAb)

GLP2R Rabbit mAb (A22049)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GLP2R Rabbit mAb (A22049) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	GLP2R Rabbit mAb
Catalog No.	A22049
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54969

Background

This gene encodes a G protein-coupled receptor that is closely related to the glucagon receptor and binds to glucagon-like peptide-2 (GLP2). Signalling through GLP2 stimulates intestinal growth and increases villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 460-553 of human GLP2R (NP_004237.1).
Sequence	SGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTMANTMEEILEESEI
Gene ID
Swiss Prot
Synonyms	GLP2R
Calculated MW	63kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, HeLa, Mouse brain, Rat brain, Rat liver
Cellular location	Cell membrane, Multi-pass membrane protein