제품 > 항체 > 단일클론항체(mAb)

GLUT1/SLC2A1 Rabbit mAb (A11727)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GLUT1/SLC2A1 Rabbit mAb (A11727) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using GLUT1/SLC2A1 Rabbit mAb (A11727) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using GLUT1/SLC2A1 Rabbit mAb (A11727) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using GLUT1/SLC2A1 Rabbit mAb (A11727) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - GLUT1/SLC2A1 Rabbit mAb (A11727)

Confocal imaging of paraffin-embedded Mouse liver tissue using GLUT1/SLC2A1 Rabbit mAb (A11727, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded Human prostate cancer tissue using GLUT1/SLC2A1 Rabbit mAb (A11727, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	GLUT1/SLC2A1 Rabbit mAb
Catalog No.	A11727
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0304

Background

This gene encodes a major glucose transporter in the mammalian blood-brain barrier. The encoded protein is found primarily in the cell membrane and on the cell surface, where it can also function as a receptor for human T-cell leukemia virus (HTLV) I and II. Mutations in this gene have been found in a family with paroxysmal exertion-induced dyskinesia.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 393-492 of human GLUT1/SLC2A1 (P11166).
Sequence	ELFSQGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV
Gene ID
Swiss Prot
Synonyms	CSE; PED; DYT9; GLUT; DYT17; DYT18; EIG12; GLUT1; HTLVR; GLUT-1; SDCHCN; GLUT1DS; GLUT1/SLC2A1
Calculated MW	54kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:400 - 1:4000 IF/ICC 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples	RD, SH-SY5Y, K-562, NIH/3T3, Rat kidney
Cellular location	Cell membrane, Melanosome, Multi-pass membrane protein.
Customer validation	WB(Rattus norvegicus, Homo sapiens, Mus musculus, Rattus norvegicus ) IF(Mus musculus) IHC(Mus musculus) WB(Mus musculus) IHC(Homo sapiens, Rattus norvegicus )