Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GLUT2/SLC2A2 Rabbit pAb |
---|---|
Catalog No. | A9843 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT2/GLUT2/SLC2A2 (NP_000331.1). |
---|---|
Sequence | MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS |
Gene ID | |
Swiss Prot | |
Synonyms | GLUT2; GLUT2/SLC2A2 |
Calculated MW | 57kDa |
Observed MW |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse small intestine, Rat small intestine |
Cellular location | Membrane, Multi-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mesocricetus auratus, Mus musculus, Gallus gallus) IF(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9843? Please let us know so that we can cite the reference in this datasheet.