제품 > 항체 > 다중클론항체(pAb)

GMPS Rabbit pAb (A6606)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GMPS Rabbit pAb (A6606) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - GMPS Rabbit pAb (A6606)

Immunoprecipitation analysis of 200 μg extracts of MCF-7 cells, using 3 μg GMPS antibody (A6606). Western blot was performed from the immunoprecipitate using GMPS antibody (A6606) at a dilution of 1:1000.

Review

Overview

Product name	GMPS Rabbit pAb
Catalog No.	A6606
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 394-693 of human GMPS (NP_003866.1).
Sequence	DTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
Gene ID
Swiss Prot
Synonyms	GATD7; GMPS
Calculated MW	77kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	MCF-7, SKOV3, HL-60, U-251MG, Mouse heart, Mouse kidney, Mouse brain, Rat heart
Cellular location	Cytoplasm
Customer validation	(Human colon cancer cell, Human promyelocytic leukemia cells)