제품 > 항체 > 단일클론항체(mAb)

GNAQ Rabbit mAb (A21111)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GNAQ Rabbit mAb (A21111) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from HeLa cells, using GNAQ Rabbit mAb (A21111) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - GNAQ Rabbit mAb (A21111)

Immunohistochemistry analysis of GNAQ in paraffin-embedded human pancreas tissue using GNAQ Rabbit mAb (A21111) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GNAQ in paraffin-embedded rat kidney tissue using GNAQ Rabbit mAb (A21111) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of GNAQ in paraffin-embedded human prostate tissue using GNAQ Rabbit mAb (A21111) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	GNAQ Rabbit mAb
Catalog No.	A21111
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3048

Background

This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human GNAQ (NP_002063.2).
Sequence	SGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRRE
Gene ID
Swiss Prot
Synonyms	GAQ; SWS; CMAL; CMC1; G-ALPHA-q; GNAQ
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Mouse brain, Mouse lung, Rat brain
Cellular location	Membrane, Nucleus, Nucleus membrane
Customer validation	WB(Homo sapiens)