Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of lysates from PC-12 cells, using GPR109A/HM74A/HCAR2 Rabbit mAb (A21974) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
| Product name | GPR109A/HM74A/HCAR2 Rabbit mAb |
|---|---|
| Catalog No. | A21974 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC54160 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR109A/HM74A/HCAR2 (NP_808219.1). |
|---|---|
| Sequence | CRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HCA2; HM74a; HM74b; PUMAG; NIACR1; Puma-g; GPR109A; GPR109A/HM74A/HCAR2 |
| Calculated MW | 42kDa |
| Observed MW | 42kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse lung, Mouse Thymus |
| Cellular location | Cell junction, Plasma membrane |
| Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21974? Please let us know so that we can cite the reference in this datasheet.
