제품 > 항체 > 다중클론항체(pAb)

GPR182 Rabbit pAb (A14854)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using GPR182 Rabbit pAb (A14854) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	GPR182 Rabbit pAb
Catalog No.	A14854
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that the encoded protein may function as a receptor for adrenomedullin.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human GPR182 (NP_009195.1).
Sequence	QPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCA
Gene ID
Swiss Prot
Synonyms	AMR; 7TMR; ADMR; AM-R; G10D; L1-R; gamrh; hrhAMR; GPR182
Calculated MW	45kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	LO2, 293T, mouse liver
Cellular location	Cell membrane, Multi-pass membrane protein