Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using GST3/GSTP1 Rabbit mAb (A19061) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver using GST3/GSTP1 Rabbit mAb (A19061) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | GST3/GSTP1 Rabbit mAb |
|---|---|
| Catalog No. | A19061 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0439 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211). |
|---|---|
| Sequence | LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22; GST3/GSTP1 |
| Calculated MW | 23kDa |
| Observed MW | 25kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | PC-3 cells, TE-1 cells, U-251MG cells, Mouse brain, Mouse lung, Rat brain, Rat kidney |
| Cellular location | Cytoplasm, Mitochondrion, Nucleus. |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19061? Please let us know so that we can cite the reference in this datasheet.
