제품 > 항체 > 다중클론항체(pAb)

Galectin 8/LGALS8 Rabbit pAb (A6646)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Galectin 8/LGALS8 Rabbit pAb (A6646) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Galectin 8/LGALS8 Rabbit pAb (A6646)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Galectin 8/LGALS8 Rabbit pAb (A6646) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using Galectin 8/LGALS8 Rabbit pAb (A6646) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Galectin 8/LGALS8 Rabbit pAb (A6646)

Immunofluorescence analysis of A549 cells using Galectin 8/LGALS8 Rabbit pAb (A6646). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Galectin 8/LGALS8 Rabbit pAb
Catalog No.	A6646
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-317 of human Galectin 8/Galectin 8/LGALS8 (NP_963838.1).
Sequence	VGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Gene ID
Swiss Prot
Synonyms	Gal-8; PCTA1; PCTA-1; Po66-CBP; Galectin 8/LGALS8
Calculated MW	36kDa
Observed MW	38kDa/50kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	BT-474, 22Rv1, Mouse liver, Mouse small intestine
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens) IF(Homo sapiens) IP(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Galectin 8/LGALS8 Rabbit pAb images

Western blot - Galectin 8/LGALS8 Rabbit pAb (A6646)

Immunohistochemistry - Galectin 8/LGALS8 Rabbit pAb (A6646)

Immunofluorescence - Galectin 8/LGALS8 Rabbit pAb (A6646)

Immunofluorescence analysis of A549 cells using Galectin 8/LGALS8 Rabbit pAb (A6646). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.