Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GluR1/GRIA1 Rabbit pAb |
---|---|
Catalog No. | A1826 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2). |
---|---|
Sequence | PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD |
Gene ID | |
Swiss Prot | |
Synonyms | GLUH1; GLUR1; GLURA; GluA1; HBGR1; MRD67; MRT76; GluR1/GRIA1 |
Calculated MW | 102kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum membrane, Multi-pass membrane protein, dendrite, dendritic spine, postsynaptic cell membrane, postsynaptic density, synapse. |
Customer validation | WB(Mus musculus, Rattus norvegicus) IF(Anatinae) Co-IP(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1826? Please let us know so that we can cite the reference in this datasheet.