제품 > 항체 > 단일클론항체(mAb)

Granzyme B Rabbit mAb (A22993)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Granzyme B Rabbit mAb (A22993) at dilution of 1:400 (40x lens). Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using Granzyme B Rabbit mAb (A22993) at dilution of 1:400 (40x lens). Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	Granzyme B Rabbit mAb
Catalog No.	A22993
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55455

Background

This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Granzyme B (NP_004122.2).
Sequence	YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
Gene ID
Swiss Prot
Synonyms	C11; HLP; CCPI; CGL1; CSPB; SECT; CGL-1; CSP-B; CTLA1; CTSGL1; Granzyme B
Calculated MW	28kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples	HL-60, A-549
Cellular location	Cytoplasmic granule
Customer validation	IF(Homo sapiens)