Review (1)Publication (1) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HACE1 Rabbit pAb |
---|---|
Catalog No. | A9593 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HACE1 (NP_065822.2). |
---|---|
Sequence | MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCT |
Gene ID | |
Swiss Prot | |
Synonyms | SPPRS; HACE1 |
Calculated MW | 102kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, HeLa, Mouse brain, Mouse lung, Mouse spleen, Mouse testis |
Cellular location | Cytoplasm, Endoplasmic reticulum, Golgi apparatus, Golgi stack membrane |
Customer validation | (Mouse bv2) WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A9593? Please let us know so that we can cite the reference in this datasheet.