제품 > 항체 > 다중클론항체(pAb)

HAUS8 Rabbit pAb (A7847)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using HAUS8 antibody (A7847) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - HAUS8 Rabbit pAb (A7847)

Immunofluorescence analysis of U2OS cells using HAUS8 antibody (A7847) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	HAUS8 Rabbit pAb
Catalog No.	A7847
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare, ' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 166-410 of human HAUS8 (NP_219485.1).
Sequence	NLAEFERRAEKNLLIMCKEKEKLQKKAHELKRRLLLSQRKRELADVLDAQIEMLSPFEAVATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRLLGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELSAEASKEAALANQEVWEETQGMAPPSRWYFNQDSACRESGGAPKNTPLSEDDNPGASSAPAQATFISPSEDFSSSSQAEVPPSLSRSGRDLS
Gene ID
Swiss Prot
Synonyms	DGT4; HICE1; NY-SAR-48
Calculated MW	45kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat, NCI-H460, Mouse testis
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center, spindle, spindle pole
Customer validation	WB(Homo sapiens)