Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | HAVCR1 Rabbit pAb |
---|---|
Catalog No. | A2831 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human HAVCR1 (NP_036338.2). |
---|---|
Sequence | SVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIV |
Gene ID | |
Swiss Prot | |
Synonyms | TIM; KIM1; TIM1; CD365; HAVCR; KIM-1; TIM-1; TIMD1; TIMD-1; HAVCR-1; HAVCR1 |
Calculated MW | 39kDa |
Observed MW | 50-140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, HeLa, Jurkat, PC-12, Mouse spleen, Rat testis |
Cellular location | Membrane, Single-pass type I membrane protein. |
Customer validation | IHC(Rattus norvegicus, Mus musculus) WB(Drosophila melanogaster, Mus musculus, Homo sapiens, Rattus norvegicus) WB(Mus musculus, Rattus norvegicus) IF(Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2831? Please let us know so that we can cite the reference in this datasheet.