제품 > 항체 > 단일클론항체(mAb)

HB-EGF Rabbit mAb (A11657)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HB-EGF Rabbit mAb (A11657) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	HB-EGF Rabbit mAb
Catalog No.	A11657
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0663

Background

Enables growth factor activity and heparin binding activity. Involved in several processes, including epidermal growth factor receptor signaling pathway; positive regulation of protein kinase B signaling; and positive regulation of wound healing. Located in cell surface and extracellular space. Implicated in glomerulosclerosis and perinatal necrotizing enterocolitis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075).
Sequence	LLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPV
Gene ID
Swiss Prot
Synonyms	DTR; DTS; DTSF; HEGFL; HB-EGF
Calculated MW	23kDa
Observed MW	18-28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SK-OV-3, Mouse lung, Mouse spleen, Rat spleen
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein, extracellular space.