Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using HDAC3 Rabbit mAb (A19537) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunoprecipitation of HDAC3 from 300 µg extracts of HeLa cells was performed using 3 µg of HDAC3 Rabbit mAb (A19537). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using HDAC3 Rabbit mAb (A19537) at a dilution of 1:1000.
| Product name | HDAC3 Rabbit mAb |
|---|---|
| Catalog No. | A19537 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0016 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 329-428 of human HDAC3 (NP_003874.2). |
|---|---|
| Sequence | FEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HD3; RPD3; KDAC3; RPD3-2; HDAC3 |
| Calculated MW | 49kDa |
| Observed MW | 49kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunoprecipitation |
| Positive samples | PC-3, HeLa, Mouse brain, NIH/3T3, Rat testis |
| Cellular location | Cytoplasm, Nucleus, cytosol. |
| Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus) Co-IP(Homo sapiens) IF(Mus musculus) ChIP(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19537? Please let us know so that we can cite the reference in this datasheet.
