Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | HIF1β/ARNT Rabbit pAb |
---|---|
Catalog No. | A0972 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 420-485 of human HIF1β/ARNT (NP_001659.1). |
---|---|
Sequence | GQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLG |
Gene ID | |
Swiss Prot | |
Synonyms | HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta |
Calculated MW | 87kDa |
Observed MW | 87kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HL-60, Mouse lung |
Cellular location | Nucleus |
Customer validation | WB(Homo sapiens, Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0972? Please let us know so that we can cite the reference in this datasheet.