Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | HLA-DRB1 Rabbit pAb |
---|---|
Catalog No. | A7685 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human HLA-DRB1 (NP_002115.2). |
---|---|
Sequence | GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLS |
Gene ID | |
Swiss Prot | |
Synonyms | SS1; DRB1; HLA-DRB; HLA-DR1B |
Calculated MW | 30kDa |
Observed MW | 30kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7, Mouse thymus, Mouse spleen, Mouse heart |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane |
Customer validation | IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7685? Please let us know so that we can cite the reference in this datasheet.