제품 > 항체 > 단일클론항체(mAb)

HMGB2 Rabbit mAb (A9168)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1μg HMGB2 Rabbit mAb(A9168), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of HMGB2 in representative gene loci (PTBP1), as shown in figure.

ABclonal:Western blot - HMGB2 Rabbit mAb (A9168)

Western blot analysis of various lysates using HMGB2 Rabbit mAb (A9168) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - HMGB2 Rabbit mAb (A9168)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using HMGB2 Rabbit mAb (A9168) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using HMGB2 Rabbit mAb (A9168) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using HMGB2 Rabbit mAb (A9168) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using HMGB2 Rabbit mAb (A9168) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using HMGB2 Rabbit mAb (A9168) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - HMGB2 Rabbit mAb (A9168)

Confocal imaging of U-2 OS cells using HMGB2 Rabbit mAb (A9168, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - HMGB2 Rabbit mAb (A9168)

Immunoprecipitation analysis of 300 μg extracts from Mouse testis using 3 μg HMGB2 antibody (A9168). Western blot was performed from the immunoprecipitate using HMGB2 (A9168) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - HMGB2 Rabbit mAb (A9168)

Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using HMGB2 antibody (A9168) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review

Overview

Product name	HMGB2 Rabbit mAb
Catalog No.	A9168
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1460

Background

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGB2 (P26583).
Sequence	MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPS
Gene ID
Swiss Prot
Synonyms	HMG2; HMGB2
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin CUT&Tag 10⁵ cells /1 μg
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, HepG2, RAW264.7, THP-1, Mouse testis, Rat testis, Rat spleen, Rat thymus
Cellular location	Chromosome, Cytoplasm, Nucleus, Secreted.
Customer validation	(HEK293T cells) IF(Mus musculus) mIHC(Homo sapiens)