제품 > 항체 > 다중클론항체(pAb)

HNRNPR Rabbit pAb (A5883)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HNRNPR Rabbit pAb (A5883) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review

Overview

Product name	HNRNPR Rabbit pAb
Catalog No.	A5883
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1).
Sequence	RGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
Gene ID
Swiss Prot
Synonyms	HNRPR; NEDDFSB; hnRNP-R; HNRNPR
Calculated MW	71kDa
Observed MW	71kDa/77kDa/80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-251 MG, SK-OV-3, L-02, HL-60, Mouse brain, Rat brain
Cellular location	Cytoplasm, Nucleus, nucleoplasm
Customer validation	(293T)