제품 > 항체 > 단일클론항체(mAb)

HRH3 Rabbit mAb (A3500)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HRH3 Rabbit mAb (A3500) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - HRH3 Rabbit mAb (A3500)

Immunoprecipitation analysis of 300 μg extracts of Raji cells using 3 μg HRH3 antibody (A3500). Western blot was performed from the immunoprecipitate using HRH3 antibody (A3500) at a dilution of 1:1000.

Overview

Product name	HRH3 Rabbit mAb
Catalog No.	A3500
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2016

Background

Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene encodes one of the histamine receptors (H3) which belongs to the family 1 of G protein-coupled receptors. It is an integral membrane protein and can regulate neurotransmitter release. This receptor can also increase voltage-dependent calcium current in smooth muscles and innervates the blood vessels and the heart in cardiovascular system.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HRH3 (Q9Y5N1).
Sequence	MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRW
Gene ID
Swiss Prot
Synonyms	HH3R; GPCR97; HRH3
Calculated MW	49kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Mouse testis, Mouse brain, Mouse spleen, Rat testis, Rat brain, Rat spleen, Raji, SH-SY5Y, U-251MG
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus)