Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | HRPT2 / CDC73 Rabbit pAb |
---|---|
Catalog No. | A0636 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 435-505 of human HRPT2 / CDC73 (Q6P1J9). |
---|---|
Sequence | MPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRH |
Gene ID | |
Swiss Prot | |
Synonyms | HYX; FIHP; HPTJT; HRPT1; HRPT2; C1orf28; HRPT2 / CDC73 |
Calculated MW | 61kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | |
Cellular location | Nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.