Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | HSD3B1 Rabbit mAb |
---|---|
Catalog No. | A19266 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2437 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060). |
---|---|
Sequence | RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK |
Gene ID | |
Swiss Prot | |
Synonyms | HSD3B; HSDB3; HSDB3A; SDR11E1; 3BETAHSD; HSD3B1 |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse liver, Rat ovary |
Cellular location | Endoplasmic reticulum membrane, Mitochondrion membrane, Single-pass membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens, Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19266? Please let us know so that we can cite the reference in this datasheet.