Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using HSP60/HSPD1 Rabbit pAb (A0969) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using HSP60/HSPD1 Rabbit pAb (A0969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using HSP60/HSPD1 Rabbit pAb (A0969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using HSP60/HSPD1 Rabbit pAb (A0969) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal immunofluorescence analysis of HeLa cells using HSP60/HSPD1 Rabbit pAb (A0969) at dilution of 1:400. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U2OS cells using HSP60/HSPD1 Rabbit pAb (A0969) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | HSP60/HSPD1 Rabbit pAb |
|---|---|
| Catalog No. | A0969 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-240 of human HSP60/HSPD1 (NP_002147.2). |
|---|---|
| Sequence | AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HLD4; CPN60; GROEL; HSP60; HSP65; SPG13; HSP-60; HuCHA60; HSP60/HSPD1 |
| Calculated MW | 61kDa |
| Observed MW | 61kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, Jurkat, K-562, Mouse kidney, Mouse liver, Mouse thymus, Rat heart |
| Cellular location | Mitochondrion matrix |
| Customer validation | WB(Mus musculus, Sus scrofa, Homo sapiens, Gallus gallus, Bos taurus, Mus musculus) IF(Mus musculus, Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0969? Please let us know so that we can cite the reference in this datasheet.
