제품 > 항체 > 다중클론항체(pAb)

HSPA6 Rabbit pAb (A7688)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HSPA6 Rabbit pAb (A7688) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - HSPA6 Rabbit pAb (A7688)

Immunohistochemistry analysis of paraffin-embedded Human liver using HSPA6 Rabbit pAb (A7688) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	HSPA6 Rabbit pAb
Catalog No.	A7688
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables enzyme binding activity; heat shock protein binding activity; and unfolded protein binding activity. Involved in cellular response to heat and protein refolding. Located in centriole and cytosol. Colocalizes with COP9 signalosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 474-643 of human HSPA6 (NP_002146.2).
Sequence	PQIEVTFDIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Gene ID
Swiss Prot
Synonyms	HSP70B'; HSPA6
Calculated MW	71kDa
Observed MW	71kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, Mouse heart, Rat brain, Rat heart
Cellular location	blood microparticle, centriole, cytoplasm, cytosol, extracellular exosome, extracellular region, nucleus, plasma membrane
Customer validation	IF(Sus scrofa) WB(Sus scrofa)