제품 > 항체 > 다중클론항체(pAb)

HSPB2 Rabbit pAb (A2350)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using HSPB2 antibody (A2350) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - HSPB2 Rabbit pAb (A2350)

Immunofluorescence analysis of U2OS cells using HSPB2 antibody (A2350). Blue: DAPI for nuclear staining.

Overview

Product name	HSPB2 Rabbit pAb
Catalog No.	A2350
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-182 of human HSPB2 (NP_001532.1).
Sequence	MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
Gene ID
Swiss Prot
Synonyms	MKBP; HSP27; Hs.78846; LOH11CR1K
Calculated MW	20kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	BT-474, HeLa, Mouse skeletal muscle
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus)