Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and Histone H3.3 Rabbit mAb (A4835). The ChIP sequencing results indicate the enrichment pattern of Histone H3.3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.
Western blot analysis of lysates from Rat lung, using Histone H3.3 Rabbit mAb (A4835) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of various lysates using Histone H3.3 Rabbit mAb (A4835) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using Histone H3.3 Rabbit mAb (A4835) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophageal using Histone H3.3 Rabbit mAb (A4835) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver using Histone H3.3 Rabbit mAb (A4835) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Histone H3.3 antibody (A4835) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
| Product name | Histone H3.3 Rabbit mAb |
|---|---|
| Catalog No. | A4835 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0255 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243). |
|---|---|
| Sequence | KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H3F3; H3-3B; H3.3A; H3F3A; BRYLIB1; Histone H3.3 |
| Calculated MW | 15kDa |
| Observed MW | 17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, 294T, Mouse lungRat lung |
| Cellular location | Chromosome, Nucleus. |
| Customer validation | (MOLT-4、Jurkat、HELA、HEPG2, MOLT-4 Jurkat HELA HeLa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
