제품 > 항체 > 단일클론항체(mAb)

Human IgG (Fc) Rabbit mAb (A21291)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from control Human plasma, using Human IgG (Fc) Rabbit mAb (A21291) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.2s.

ABclonal:Immunohistochemistry - Human IgG (Fc) Rabbit mAb (A21291)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Human IgG (Fc) Rabbit mAb (A21291) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Human IgG (Fc) Rabbit mAb (A21291)

Confocal imaging of human tonsil using Human IgG (Fc) Rabbit mAb (A21291, at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Overview

Product name	Human IgG (Fc) Rabbit mAb
Catalog No.	A21291
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53376

Background

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response; positive regulation of hypersensitivity; and positive regulation of phagocytosis. Located in extracellular space.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human IgG (Fc) mAb (P01857).
Sequence	PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Gene ID
Swiss Prot
Synonyms
Calculated MW	52kDa
Observed MW	50-55kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 IHC-P 1:100 - 1:500 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Human plasma
Cellular location
Customer validation	ChIP(Mus musculus) qPCR(Mus musculus)