제품 > 항체 > 다중클론항체(pAb)

IFI6 Rabbit pAb (A6157)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from K-562 cells, using IFI6 Rabbit pAb (A6157) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	IFI6 Rabbit pAb
Catalog No.	A6157
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human IFI6 (NP_002029.3).
Sequence	MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
Gene ID
Swiss Prot
Synonyms	6-16; G1P3; FAM14C; IFI616; IFI-6-16; IFI6
Calculated MW	13kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	K-562
Cellular location	Membrane, Multi-pass membrane protein.
Customer validation	WB(Mus musculus)