제품 > 항체 > 단일클론항체(mAb)

βII-Tubulin/β2-Tubulin Rabbit mAb (A4798)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - βII-Tubulin/β2-Tubulin Rabbit mAb (A4798)

Immunohistochemistry analysis of paraffin-embedded Rat brain using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - βII-Tubulin/β2-Tubulin Rabbit mAb (A4798)

Immunofluorescence analysis of C6 cells using βII-Tubulin/β2-Tubulin Rabbit mAb (A4798) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	βII-Tubulin/β2-Tubulin Rabbit mAb
Catalog No.	A4798
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0227

Background

Microtubules, key participants in processes such as mitosis and intracellular transport, are composed of heterodimers of alpha- and beta-tubulins. The protein encoded by this gene is a beta-tubulin. Defects in this gene are associated with complex cortical dysplasia with other brain malformations-5. Two transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 346-445 of human βII-Tubulin/β2-Tubulin (Q13885).
Sequence	PNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Gene ID
Swiss Prot
Synonyms	CDCBM5; TUBB; TUBB2; βII-Tubulin/β2-Tubulin
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	C6, U-251MG, Mouse brain
Cellular location	Cytoplasm, cytoskeleton, Microtubule
Customer validation	WB(Homo sapiens, Other)