제품 > 항체 > 다중클론항체(pAb)

IL18 Rabbit pAb (A20473)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IL18 Rabbit pAb (A20473) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat brain, using IL18 Rabbit pAb (A20473) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of Recombinant Human IL-18 Protein (RP00006) using IL18 Rabbit pAb (A20473) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 10ng/5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - IL18 Rabbit pAb (A20473)

Immunohistochemistry analysis of paraffin-embedded Human tonsil using IL18 Rabbit pAb (A20473) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using IL18 Rabbit pAb (A20473) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using IL18 Rabbit pAb (A20473) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	IL18 Rabbit pAb
Catalog No.	A20473
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cytokine activity. Involved in lipid homeostasis; positive regulation of cell differentiation; and positive regulation of cold-induced thermogenesis. Acts upstream of or within several processes, including interleukin-18-mediated signaling pathway; positive regulation of NIK/NF-kappaB signaling; and positive regulation of interferon-gamma production. Located in extracellular space. Is expressed in several structures, including back skin; dorsal aorta; gut; lymphatic system; and reproductive system. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; allergic rhinitis; autoimmune disease (multiple); biliary atresia; and hepatitis B. Orthologous to human IL18 (interleukin 18).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 36-192 of mouse IL18 (NP_032386.1).
Sequence	NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Gene ID
Swiss Prot
Synonyms	Igif; Il-18; IL18
Calculated MW	22kDa
Observed MW	22kDa/18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	RAW264.7, Mouse spleen, Rat brain, Recombinant Human IL-18 Protein
Cellular location	apical plasma membrane, cytoplasm, extracellular space.
Customer validation	WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Homo sapiens) IHC(Mus musculus, Rattus norvegicus)