제품 > 항체 > 단일클론항체(mAb)

IL22 Rabbit mAb (A24612)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of normal 293T cells and 293T transfected with IL22 using IL22 Rabbit mAb (A24612) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunofluorescence - IL22 Rabbit mAb (A24612)

Confocal imaging of 293F-IL22 and 293F cells using IL22 Rabbit mAb (A24612, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	IL22 Rabbit mAb
Catalog No.	A24612
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63986

Background

This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 34-179 of human IL22(NP_065386.1).
Sequence	APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Gene ID
Swiss Prot
Synonyms	TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23; IL22
Calculated MW	20kDa
Observed MW	16kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T transfected with IL22 (Human)
Cellular location	Secreted.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IL22 Rabbit mAb images

Western blot - IL22 Rabbit mAb (A24612)

Immunofluorescence - IL22 Rabbit mAb (A24612)

Confocal imaging of 293F-IL22 and 293F cells using IL22 Rabbit mAb (A24612, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

* For research use only. Not for therapeutic or diagnostic purposes.