제품 > 항체 > 단일클론항체(mAb)

IRF2 Rabbit mAb (A4843)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HeLa cells, using IRF2 Rabbit mAb (A4843) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunoprecipitation - IRF2 Rabbit mAb (A4843)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg IRF2 antibody (A4843). Western blot was performed from the immunoprecipitate using IRF2 (A4843) at a dilution of 1:500.

Overview

Product name	IRF2 Rabbit mAb
Catalog No.	A4843
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0265

Background

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-349 of human IRF2 (P14316).
Sequence	PHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Gene ID
Swiss Prot
Synonyms	IRF-2; IRF2
Calculated MW	39kDa
Observed MW	50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

IRF2 Rabbit mAb images

Western blot - IRF2 Rabbit mAb (A4843)

Immunoprecipitation - IRF2 Rabbit mAb (A4843)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg IRF2 antibody (A4843). Western blot was performed from the immunoprecipitate using IRF2 (A4843) at a dilution of 1:500.

* For research use only. Not for therapeutic or diagnostic purposes.