제품 > 항체 > 단일클론항체(mAb)

IRF5 Rabbit mAb (A11106)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using IRF5 Rabbit mAb (A11106) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min.

ABclonal:Immunoprecipitation - IRF5 Rabbit mAb (A11106)

Immunoprecipitation analysis of 600 μg extracts of Mouse thymus using 3 μg IRF5 antibody (A11106). Western blot was performed from the immunoprecipitate using IRF5 antibody (A11106) at a dilution of 1:500.

Overview

Product name	IRF5 Rabbit mAb
Catalog No.	A11106
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0525

Background

This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 6-151 of human IRF5 (Q13568).
Sequence	PVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQ
Gene ID
Swiss Prot
Synonyms	SLEB10; IRF5
Calculated MW	56kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	293T, Jurkat, Mouse lung, Mouse spleen, Mouse thymus
Cellular location	Cytoplasm, Nucleus.
Customer validation	IHC(Homo sapiens)