제품 > 항체 > 단일클론항체(mAb)

Integrin alpha 4 (ITGA4/CD49d) Rabbit mAb (A4054)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Integrin alpha 4 (ITGA4/CD49d) (ITGA4/CD49d) Rabbit mAb (A4054) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Integrin alpha 4 (ITGA4/CD49d) Rabbit mAb (A4054)

Immunohistochemistry analysis of paraffin-embedded Mouse testis using Integrin alpha 4 (ITGA4/CD49d) (ITGA4/CD49d) Rabbit mAb (A4054) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	Integrin alpha 4 (ITGA4/CD49d) Rabbit mAb
Catalog No.	A4054
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0888

Background

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 4 subunit. This subunit associates with a beta 1 or beta 7 subunit to form an integrin that may play a role in cell motility and migration. This integrin is a therapeutic target for the treatment of multiple sclerosis, Crohn's disease and inflammatory bowel disease. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 933-1032 of human Integrin alpha 4 (ITGA4/CD49d) (P13612).
Sequence	ALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRDSWSYINSKSNDD
Gene ID
Swiss Prot
Synonyms	IA4; CD49D; Integrin alpha 4 (ITGA4/CD49d)
Calculated MW	115kDa
Observed MW	70kDa/140kDa/150kDa/200kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, Mouse spleen, Rat spleen
Cellular location	Membrane, Single-pass type I membrane protein.