Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | JNK3 Rabbit mAb |
---|---|
Catalog No. | A19075 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0366 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human MAPK10 (P53779). |
---|---|
Sequence | VDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTD |
Gene ID | |
Swiss Prot | |
Synonyms | JNK3; JNK3A; PRKM10; SAPK1b; p493F12; p54bSAPK |
Calculated MW | 44kDa |
Observed MW | 53kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7, Mouse brain, Mouse testis, Rat brain, Rat testis |
Cellular location | Cytoplasm, Lipid-anchor, Membrane, Mitochondrion, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.