제품 > 항체 > 단일클론항체(mAb)

KDM5A Rabbit mAb (A4755)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KDM5A Rabbit mAb (A4755) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from Mouse lung, using KDM5A Rabbit mAb (A4755) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunoprecipitation - KDM5A Rabbit mAb (A4755)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg KDM5A antibody (A4755). Western blot was performed from the immunoprecipitate using KDM5A antibody (A4755) at a dilution of 1:500.

ABclonal:Chromatin Immunoprecipitation - KDM5A Rabbit mAb (A4755)

Chromatin immunoprecipitation analysis of extracts of HCT116 cells, using KDM5A antibody (A4755) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	KDM5A Rabbit mAb
Catalog No.	A4755
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1120

Background

This gene encodes a member of the Jumonji, AT-rich interactive domain 1 (JARID1) histone demethylase protein family. The encoded protein plays a role in gene regulation through the histone code by specifically demethylating lysine 4 of histone H3. The encoded protein interacts with many other proteins, including retinoblastoma protein, and is implicated in the transcriptional regulation of Hox genes and cytokines. This gene may play a role in tumor progression.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1400-1690 of human KDM5A (P29375).
Sequence	HAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKDSSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNKLAKKLAKEEERKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPVSPGPAPPPSFIMSYKLPMEDLKETS
Gene ID
Swiss Prot
Synonyms	RBP2; RBBP2; RBBP-2; KDM5A
Calculated MW	192kDa
Observed MW	200kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 2μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, HepG2, Mouse lung
Cellular location	Nucleus, nucleolus.
Customer validation	ChIP(Mus musculus) WB(Mus musculus) IF(Mus musculus)