제품 > 항체 > 다중클론항체(pAb)

KDM6A Rabbit pAb (A8159)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using KDM6A Rabbit pAb (A8159) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - KDM6A Rabbit pAb (A8159)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using KDM6A Rabbit pAb (A8159) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	KDM6A Rabbit pAb
Catalog No.	A8159
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA binding activity; histone H3-tri/di-methyl-lysine-27 demethylase activity; and identical protein binding activity. Involved in chromatin remodeling. Acts upstream of or within several processes, including chordate embryonic development; embryonic morphogenesis; and histone H3-K27 demethylation. Located in nucleus. Part of histone methyltransferase complex. Is expressed in several structures, including early conceptus; gonad; liver; lung; and spleen. Used to study chronic myelomonocytic leukemia. Human ortholog(s) of this gene implicated in several diseases, including Kabuki syndrome; bladder urothelial carcinoma; gastrointestinal system cancer (multiple); lung carcinoma (multiple); and triple-receptor negative breast cancer. Orthologous to human KDM6A (lysine demethylase 6A).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 550-700 of mouse KDM6A (NP_033509.1).
Sequence	MPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLS
Gene ID
Swiss Prot
Synonyms	Utx; KDM6A
Calculated MW	154kDa/157kDa
Observed MW	180kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	T-47D, THP-1(negative)
Cellular location	Nucleus.
Customer validation	WB(Escherichia coli, Mus musculus, Homo sapiens) IF(Mus musculus) Other(Sus scrofa)