제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Cyclophilin F Rabbit mAb (A25355)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HAP1 cells using [KD Validated] Cyclophilin F Rabbit mAb (A25355) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type (WT) and Cyclophilin F knockdown (KD) 293F cells using [KD Validated] Cyclophilin F Rabbit mAb (A25355) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KD Validated] Cyclophilin F Rabbit mAb (A25355)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KD Validated] Cyclophilin F Rabbit mAb (A25355) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] Cyclophilin F Rabbit mAb (A25355) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	[KD Validated] Cyclophilin F Rabbit mAb
Catalog No.	A25355
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66521

Background

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 108-207of human Cyclophilin F (NP_005720.1).
Sequence	DFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Gene ID
Swiss Prot
Synonyms	CYP3; CypD; CyP-M; Cyp-D
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:18000 IHC-P 1:300 - 1:3000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HAP1, 293F
Cellular location	cytoplasm, mitochondrial inner membrane, mitochondrial matrix, mitochondrial permeability transition pore complex, mitochondrion, Mitochondrion matrix.