제품 > 항체 > 단일클론항체(mAb)

[KD Validated] MCCC1 Rabbit mAb (A25002)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] MCCC1 Rabbit mAb (A25002) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Western blot analysis of lysates from Mouse liver using [KD Validated] MCCC1 Rabbit mAb (A25002) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Western blot analysis of lysates from wild type (WT) and MCCC1 knockdown (KD) 293T cells using [KD Validated] MCCC1 Rabbit mAb (A25002) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunofluorescence - [KD Validated] MCCC1 Rabbit mAb (A25002)

Confocal imaging of T-47D cells using [KD Validated] MCCC1 Rabbit mAb (A25002, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - [KD Validated] MCCC1 Rabbit mAb (A25002)

Immunoprecipitation of MCCC1 in 300 µg extracts from T-47D cells using 3 µg [KD Validated] MCCC1 Rabbit mAb (A25002). Western blot analysis was performed using [KD Validated] MCCC1 Rabbit mAb (A25002) at 1:2000 dilution.

Overview

Product name	[KD Validated] MCCC1 Rabbit mAb
Catalog No.	A25002
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63817

Background

This gene encodes the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 640-725 of human MCCC1(NP_064551.3).
Sequence	VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE
Gene ID
Swiss Prot
Synonyms	MCCA; MCC-B; MCCCalpha; [KD Validated] MCCC1
Calculated MW	80kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	U-2 OS, Mouse liver, Rat heart, 293T
Cellular location	Mitochondrion matrix