제품 > 항체 > 다중클론항체(pAb)

[KD Validated] MRPL11 Rabbit pAb (A24775)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and MRPL11 knockdown (KD) HeLa cells using [KD Validated] MRPL11 Rabbit pAb (A24775) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - [KD Validated] MRPL11 Rabbit pAb (A24775)

Immunoprecipitation of MRPL11 in 500 µg extracts from HeLa cells using 3 µg MRPL11 Rabbit pAb (A24775). Western blot analysis was performed using MRPL11 Rabbit pAb (A24775) at 1:1000 dilution.

Overview

Product name	[KD Validated] MRPL11 Rabbit pAb
Catalog No.	A24775
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 91-192 of human MRPL11(NP_057134.1).
Sequence	LKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK
Gene ID
Swiss Prot
Synonyms	MRPL11; CGI-113; L11MT; MRP-L11; mitochondrial ribosomal protein L11
Calculated MW	18kDa/19kDa/20kDa
Observed MW	21kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa,
Cellular location	Mitochondrion

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] MRPL11 Rabbit pAb images

Western blot - [KD Validated] MRPL11 Rabbit pAb (A24775)

Immunoprecipitation - [KD Validated] MRPL11 Rabbit pAb (A24775)

Immunoprecipitation of MRPL11 in 500 µg extracts from HeLa cells using 3 µg MRPL11 Rabbit pAb (A24775). Western blot analysis was performed using MRPL11 Rabbit pAb (A24775) at 1:1000 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.